(data stored in SCRATCH zone)

EMBL: CP001163.PE27

CP001163.PE27        Location/Qualifiers
FT   CDS             21615..22517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06924"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34423"
FT                   /protein_id="ACI34423.1"
FT                   /translation="MYFSGEPAQIAEIKRLASGAVTPLYRRATNEGIQLFLAGSAGLLQ
FT                   TTEDVRFEPCPGLTAAGRGVVSPENIAFTRWLTHLQDGVLLDEQNCLMLHELWLQSGTG
FT                   RRRWEELPDDARESITALFTPKRGDWCDIWSNEDVSVWWNRLCDNVLPEKTMPFDLLTV
FT                   LSTRLDVEVNGFNGGVLNGVPSAYHWYTEQYGVKWPCGYEVNISSQGDNFIQVDFDTPW
FT                   CQPESDVIAVLSRRFSCMLEHWYAGQGCNFCGWQRYERGELVDVLWGELEWSSPTDDDE
FT                   LPEVTAPEWIVDKVAHYGG"
     MYFSGEPAQI AEIKRLASGA VTPLYRRATN EGIQLFLAGS AGLLQTTEDV RFEPCPGLTA        60
     AGRGVVSPEN IAFTRWLTHL QDGVLLDEQN CLMLHELWLQ SGTGRRRWEE LPDDARESIT       120
     ALFTPKRGDW CDIWSNEDVS VWWNRLCDNV LPEKTMPFDL LTVLSTRLDV EVNGFNGGVL       180
     NGVPSAYHWY TEQYGVKWPC GYEVNISSQG DNFIQVDFDT PWCQPESDVI AVLSRRFSCM       240
     LEHWYAGQGC NFCGWQRYER GELVDVLWGE LEWSSPTDDD ELPEVTAPEW IVDKVAHYGG       300
//

If you have problems or comments...

PBIL Back to PBIL home page