(data stored in SCRATCH zone)

EMBL: CP001163.PE3

CP001163.PE3         Location/Qualifiers
FT   CDS             3759..5879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0019"
FT                   /product="type I secretion system ATPase family protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01846"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34454"
FT                   /protein_id="ACI34454.1"
FT                   /translation="MMSKCSSHNSLYALILLAQYHNITVNAETIRHQYNTHTQDFGVTE
FT                   WLLAAKSIGLKAKYVEKHFSRLSIISLPALIWRDDGKHYILSRITKDSSRYLVYDPEQH
FT                   QSLTFSRDEFEKLYQGKVILVTSRATVVGELAKFDFSWFIPSVVKYRRILLEVLTVSAF
FT                   IQFLALITPLFFQVVMDKVLVHRGFSTLNIITIAFIIVILFEVILTGARTYIFSHTTSR
FT                   IDVELGAKLFRHLLALPVSYFENRRVGETVARVRELEQIRNFLTGQALTSVLDLFFSVI
FT                   FFCVMWYYSPQLTLVILLSLPCYVIWSLFISPLLRRRLDDKFLRNAENQAFLVETVTAI
FT                   NTIKSMAVSPQMIATWDKQLAGYVASSFRVNLVAMTGQQGIQLIQKSVMVISLWMGAHL
FT                   VISGEISIGQLIAFNMLAGQVIAPVIRLAHLWQDFQQVGISVERLGDVLNTPVEKKSGR
FT                   NILPEIQGDIEFKNVRFRYSSDGNVILNNINLYISKGDVIGIVGRSGSGKSTLTKLLQR
FT                   FYIPETGQILIDGHDLSLADPEWLRRQIGVVLQENILLNRSIIDNITLASPAVSMEQAI
FT                   EAARLAGAHDFIRELKEGYNTIVGEQGVGLSGGQRQRIAIARALVTNPRILIFDEATSA
FT                   LDYESENIIMKNMSRICKNRTVIIIAHRLSTVKNANRIIVMDNGFISEDGTHKELISKK
FT                   DSLYAYLYQLQA"
     MMSKCSSHNS LYALILLAQY HNITVNAETI RHQYNTHTQD FGVTEWLLAA KSIGLKAKYV        60
     EKHFSRLSII SLPALIWRDD GKHYILSRIT KDSSRYLVYD PEQHQSLTFS RDEFEKLYQG       120
     KVILVTSRAT VVGELAKFDF SWFIPSVVKY RRILLEVLTV SAFIQFLALI TPLFFQVVMD       180
     KVLVHRGFST LNIITIAFII VILFEVILTG ARTYIFSHTT SRIDVELGAK LFRHLLALPV       240
     SYFENRRVGE TVARVRELEQ IRNFLTGQAL TSVLDLFFSV IFFCVMWYYS PQLTLVILLS       300
     LPCYVIWSLF ISPLLRRRLD DKFLRNAENQ AFLVETVTAI NTIKSMAVSP QMIATWDKQL       360
     AGYVASSFRV NLVAMTGQQG IQLIQKSVMV ISLWMGAHLV ISGEISIGQL IAFNMLAGQV       420
     IAPVIRLAHL WQDFQQVGIS VERLGDVLNT PVEKKSGRNI LPEIQGDIEF KNVRFRYSSD       480
     GNVILNNINL YISKGDVIGI VGRSGSGKST LTKLLQRFYI PETGQILIDG HDLSLADPEW       540
     LRRQIGVVLQ ENILLNRSII DNITLASPAV SMEQAIEAAR LAGAHDFIRE LKEGYNTIVG       600
     EQGVGLSGGQ RQRIAIARAL VTNPRILIFD EATSALDYES ENIIMKNMSR ICKNRTVIII       660
     AHRLSTVKNA NRIIVMDNGF ISEDGTHKEL ISKKDSLYAY LYQLQA                      706
//

If you have problems or comments...

PBIL Back to PBIL home page