(data stored in SCRATCH zone)

EMBL: CP001163.PE30

CP001163.PE30        Location/Qualifiers
FT   CDS             22903..23586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0050"
FT                   /product="DNA methylase family protein"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34453"
FT                   /protein_id="ACI34453.1"
FT                   /translation="MSRFIQGDCVRVMATIPGNGVDFILTDPPYLVGFRDRQGRTIAGD
FT                   KTDEWLQPACNEMYRVLKKDALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKTYTSK
FT                   AAYVGYRHECAYILAKGRPALPQKPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESFTHP
FT                   NAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAANDDWF
FT                   MPEAA"
     MSRFIQGDCV RVMATIPGNG VDFILTDPPY LVGFRDRQGR TIAGDKTDEW LQPACNEMYR        60
     VLKKDALMVS FYGWNRVDRF MAAWKNAGFS VVGHLVFTKT YTSKAAYVGY RHECAYILAK       120
     GRPALPQKPL PDVLGWKYSG NRHHPTEKPV TSLQPLIESF THPNAIVLDP FAGSGSTCVA       180
     ALQSGRRYIG IELLEQYHRA GQQRLAAVQR AMQQGAANDD WFMPEAA                     227
//

If you have problems or comments...

PBIL Back to PBIL home page