(data stored in SCRATCH zone)

EMBL: CP001163.PE31

CP001163.PE31        Location/Qualifiers
FT   CDS             23587..23808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34514"
FT                   /protein_id="ACI34514.1"
FT                   /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERL
FT                   ARQTLYRANRLFMEAYTEILELDACFKD"
     MNYAGHEKLR ADVAEVANTM CDLRARLNDM EHRCRFDSDV LVERLARQTL YRANRLFMEA        60
     YTEILELDAC FKD                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page