(data stored in SCRATCH zone)

EMBL: CP001163.PE32

CP001163.PE32        Location/Qualifiers
FT   CDS             23822..24256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07128"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34443"
FT                   /protein_id="ACI34443.1"
FT                   /translation="MYGTCETLCRELAAKYPGYTPLMLVIWSPEEIQALADGMDISLSD
FT                   PEIRTVLARLEDIPEDQRIESGISSAAAMEIISNVSENRQVTVPAELLASLIQTAEQAL
FT                   WKREWAARDYGLAVPECVTRRQAVVNQARILLKNNTHENG"
     MYGTCETLCR ELAAKYPGYT PLMLVIWSPE EIQALADGMD ISLSDPEIRT VLARLEDIPE        60
     DQRIESGISS AAAMEIISNV SENRQVTVPA ELLASLIQTA EQALWKREWA ARDYGLAVPE       120
     CVTRRQAVVN QARILLKNNT HENG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page