(data stored in SCRATCH zone)

EMBL: CP001163.PE33

CP001163.PE33        Location/Qualifiers
FT   CDS             24302..25078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34525"
FT                   /protein_id="ACI34525.1"
FT                   /translation="MNENTTLNALICRHARNLLLAQGWPEETDVDQRNPKYPGWISIYV
FT                   LLDAPRLATLLVNRHGGVLPPHLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQVSF
FT                   PYAGEWLTEDEIRAVLAAVRDAVRSVSCRVAEDTRRIRAALTTTGQTLLTRQTRRFRLV
FT                   VKESDHPCWLDEDDENLPVVLDAILNRGARFSAVEMYLVSDCIEHILSSGLACDVLRIP
FT                   DEPPRRWFDRGVLREVVREARNEIRSMADALAKIRK"
     MNENTTLNAL ICRHARNLLL AQGWPEETDV DQRNPKYPGW ISIYVLLDAP RLATLLVNRH        60
     GGVLPPHLAS AIQKLTGTGA ELVLSGSQWQ SLPVLPADGT QVSFPYAGEW LTEDEIRAVL       120
     AAVRDAVRSV SCRVAEDTRR IRAALTTTGQ TLLTRQTRRF RLVVKESDHP CWLDEDDENL       180
     PVVLDAILNR GARFSAVEMY LVSDCIEHIL SSGLACDVLR IPDEPPRRWF DRGVLREVVR       240
     EARNEIRSMA DALAKIRK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page