(data stored in SCRATCH zone)

EMBL: CP001163.PE34

CP001163.PE34        Location/Qualifiers
FT   CDS             complement(25208..25501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34431"
FT                   /protein_id="ACI34431.1"
FT                   /translation="MHDVFLRCSHIPRHRAVPCLQKSRAIRRGCTGRKGSRSLTHTADG
FT                   SCRVRPRNLSGRTTGKSRQTGRRDRVTAAAKRTLASTPARLRWRHGTARTRR"
     MHDVFLRCSH IPRHRAVPCL QKSRAIRRGC TGRKGSRSLT HTADGSCRVR PRNLSGRTTG        60
     KSRQTGRRDR VTAAAKRTLA STPARLRWRH GTARTRR                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page