(data stored in SCRATCH zone)

EMBL: CP001163.PE35

CP001163.PE35        Location/Qualifiers
FT   CDS             25496..25921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0055"
FT                   /product="antirestriction protein"
FT                   /note="identified by match to protein family HMM PF03230"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34515"
FT                   /protein_id="ACI34515.1"
FT                   /translation="MQYAKPVTLNVEECDRLSFLPYLFGNDFLYAEAYVYALAQKMMPE
FT                   YQGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSADACGIILTSLVINRQLWLY
FT                   HDSGDAGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
     MQYAKPVTLN VEECDRLSFL PYLFGNDFLY AEAYVYALAQ KMMPEYQGGF WHFIRLPDGG        60
     GYMMPDGDRF HMVNGANWFD RTVSADACGI ILTSLVINRQ LWLYHDSGDA GLTQLYRMRD       120
     AQLWRHIEFH PECNAIYAAL D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page