(data stored in SCRATCH zone)

EMBL: CP001163.PE36

CP001163.PE36        Location/Qualifiers
FT   CDS             25968..26390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34486"
FT                   /protein_id="ACI34486.1"
FT                   /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWNLSDD
FT                   ELETVMQRLDDAFEYGADVSIVHDVVRELMEEKRASRQVTVPAVMLEKVMALAGSEMKR
FT                   LYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     MYCTVKEIIR DVLDTDVPDS ECVFAVVLTR GDVRHIAQDW NLSDDELETV MQRLDDAFEY        60
     GADVSIVHDV VRELMEEKRA SRQVTVPAVM LEKVMALAGS EMKRLYAVGS ENGGDGDAFV       120
     REEREAMDVV LQALDGEHMS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page