(data stored in SCRATCH zone)

EMBL: CP001163.PE37

CP001163.PE37        Location/Qualifiers
FT   CDS             26387..26578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34448"
FT                   /protein_id="ACI34448.1"
FT                   /translation="MNISTETREILRNYKAVINARRREMGQKPLTTAQIVDEICDFVAN
FT                   QQAVFLGGHYILQGSRNR"
     MNISTETREI LRNYKAVINA RRREMGQKPL TTAQIVDEIC DFVANQQAVF LGGHYILQGS        60
     RNR                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page