(data stored in SCRATCH zone)

EMBL: CP001163.PE4

CP001163.PE4         Location/Qualifiers
FT   CDS             5883..7322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0020"
FT                   /product="leukotoxin secretion protein D"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01843"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34482"
FT                   /protein_id="ACI34482.1"
FT                   /translation="MRFYMKGLWDLVCRYKTVFSDVWKIRHTLDAPVREKDEYAFLPAH
FT                   LELIETPVSRRSHFVVWSILLFVIISLLLSVLGKVEVVSVANGKFTHSGRSKEIKPIEN
FT                   AIVEKIMVKDGSFVKKNDPLVELTVPGVESDILKSEASLLYEKTEQYRYAILSESIQRN
FT                   ELPEIRITDFPGGEDNAGGEHFQRVSSLIKEQFMTWQNRKNQKQITLNKKIVERDAALA
FT                   RVSLYEHQVSQEGRKLNDFKYLLNKKAVSQHSVMEQENSYIQAKNEHAVWLAQVSQLEK
FT                   EIELVREELALETNIFRSEIIEKHRKSTDNIVLLEHELEKNRQRKASSFIKAPVSGTVQ
FT                   ELNIHTEGGVVTTAETLMIIVPDNDILEVTASVLNKDIGFIQPGQEVVIKVDAYPYTRH
FT                   GYLTGKVKNITADSVSVPDTGLVFNVIISVDRNDIQGERKKIPVTAGMTVMAEIKTGVR
FT                   SVISYLLSPLKETINESLRER"
     MRFYMKGLWD LVCRYKTVFS DVWKIRHTLD APVREKDEYA FLPAHLELIE TPVSRRSHFV        60
     VWSILLFVII SLLLSVLGKV EVVSVANGKF THSGRSKEIK PIENAIVEKI MVKDGSFVKK       120
     NDPLVELTVP GVESDILKSE ASLLYEKTEQ YRYAILSESI QRNELPEIRI TDFPGGEDNA       180
     GGEHFQRVSS LIKEQFMTWQ NRKNQKQITL NKKIVERDAA LARVSLYEHQ VSQEGRKLND       240
     FKYLLNKKAV SQHSVMEQEN SYIQAKNEHA VWLAQVSQLE KEIELVREEL ALETNIFRSE       300
     IIEKHRKSTD NIVLLEHELE KNRQRKASSF IKAPVSGTVQ ELNIHTEGGV VTTAETLMII       360
     VPDNDILEVT ASVLNKDIGF IQPGQEVVIK VDAYPYTRHG YLTGKVKNIT ADSVSVPDTG       420
     LVFNVIISVD RNDIQGERKK IPVTAGMTVM AEIKTGVRSV ISYLLSPLKE TINESLRER        479
//

If you have problems or comments...

PBIL Back to PBIL home page