(data stored in SCRATCH zone)

EMBL: CP001163.PE41

CP001163.PE41        Location/Qualifiers
FT   CDS             27856..29217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34504"
FT                   /protein_id="ACI34504.1"
FT                   /translation="MTSAAITMTAPEAASPVQMYRATYSPDDNKLRLYAVSRLDPETYK
FT                   KVHDAGFRWAPKQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGYSG
FT                   KRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFERAEY
FT                   WEERGRSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLDLNMA
FT                   KLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRCHERQI
FT                   QHQQRWVNHYQNRLNYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVNKSNGAV
FT                   SSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPGEGFREMT
FT                   KAQWAALPRDCKAVRSVAEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEIPQK"
     MTSAAITMTA PEAASPVQMY RATYSPDDNK LRLYAVSRLD PETYKKVHDA GFRWAPKQAL        60
     FVAPAWTPGR EDVLLSLAGE IEDEDSTLAE RQEARAERFT GYSGKRASES AQALDEVERL       120
     AAMIPPGQPI LVGHHSERRA RRDAQRIENG MKRAVMLFER AEYWEERGRS ALLHAKYKER       180
     PDVRWRRIKK IEADLRKAEK TIAQSQKYLT MWRAESLDLN MAKLISSHDH ISACFPLDTY       240
     PRPAEKSQYE GSRSLWSALD DDIITTEQAR EIAIRCHERQ IQHQQRWVNH YQNRLNYERA       300
     MLDESGGVVT RTQDFEPGGQ VFSRGEWLTI IRVNKSNGAV SSVTTPNYSF LGYSGTMKVT       360
     PDRITDYKAP SAEEAAVASQ AAKRPPVVNY PGEGFREMTK AQWAALPRDC KAVRSVAEAE       420
     DHGAYRYRRT MDNNFRLVNV YITDMKITEI PQK                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page