(data stored in SCRATCH zone)

EMBL: CP001163.PE42

CP001163.PE42        Location/Qualifiers
FT   CDS             29264..29827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34484"
FT                   /protein_id="ACI34484.1"
FT                   /translation="MHSQLKERIRLMRARLDNAAPVAEIRAESQLFVTPAPVCDRLVTL
FT                   AEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCGDF
FT                   MEWQPVQYYSRVIINPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLPFSD
FT                   VREELPRGTFAYTDVPTMIIRLRA"
     MHSQLKERIR LMRARLDNAA PVAEIRAESQ LFVTPAPVCD RLVTLAEISN RDHILEPSAG        60
     TGAILRAIRD TAPEAMCDAV EINSGLVRYL RENFNGVRVQ CGDFMEWQPV QYYSRVIINP       120
     PFSHGQDIRH ILRAFSLLRP GGVLVAVCLN GPRQQEKLLP FSDVREELPR GTFAYTDVPT       180
     MIIRLRA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page