(data stored in SCRATCH zone)

EMBL: CP001163.PE44

CP001163.PE44        Location/Qualifiers
FT   CDS             30682..31134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0066"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34516"
FT                   /protein_id="ACI34516.1"
FT                   /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQ
FT                   TGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVK
FT                   TTGTMQMLVRAAGAQTQPEEGQQFSGQPQPQPPEGDDYGFSDDIPF"
     MAVRGINKVI LVGRLGKDPE VRYIPNGGAV ANLQVATSES WRDKQTGEMR EQTEWHRVVL        60
     FGKLAEVAGE YLRKGAQVYI EGQLRTRSWE DNGITRYVTE ILVKTTGTMQ MLVRAAGAQT       120
     QPEEGQQFSG QPQPQPPEGD DYGFSDDIPF                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page