(data stored in SCRATCH zone)

EMBL: CP001163.PE45

CP001163.PE45        Location/Qualifiers
FT   CDS             31191..31424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06006"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34521"
FT                   /protein_id="ACI34521.1"
FT                   /translation="MSEYFRILQGLPDGPFTRKHAEAVAAQYRNVFIENDHGEQFRLVV
FT                   RNNGAMVWRTWNFEDGAGYWMNHVIRDFGIIK"
     MSEYFRILQG LPDGPFTRKH AEAVAAQYRN VFIENDHGEQ FRLVVRNNGA MVWRTWNFED        60
     GAGYWMNHVI RDFGIIK                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page