(data stored in SCRATCH zone)

EMBL: CP001163.PE46

CP001163.PE46        Location/Qualifiers
FT   CDS             31490..33448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0068"
FT                   /product="plasmid partition protein B"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34501"
FT                   /protein_id="ACI34501.1"
FT                   /translation="MSVTESKAKTERKSSRKPAKTQETVLSALLAQTEEVSVPLASLIK
FT                   SPLNVRTVPYSAESVSELADSIKGVGLLQNLVVHALPGDRYGVAAGGRRLAALNMLAER
FT                   DIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIGDLL
FT                   GYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQSGWG
FT                   GKPEVQTIRRLVTESEVAVAGNSKFRFVGADTFSPDELRTDLFSDDEGGYVDCVALDAA
FT                   LLEKLQAVAEHLREAEGWEWCAGRMEPVGFCREDAGTYRSLPEPEAVLTEAEEERLNEL
FT                   MARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGSGVVVSWRYGNVCVQRGVQ
FT                   LRSEDDVADNDYRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQSDKSLALLAW
FT                   TLCLNVFGSGAYSNPARIRLECEHYSLTSDAPSGKEGAAFMAMMAEKARLAALLPDGWA
FT                   RDMTTFLSLSQEVLLSLLSFCTACSIHGVQTREYGHTSRSPLDTLESAIGFHMRDWWQP
FT                   TKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKDNRWVPGWMCAP
FT                   RPQTDATERTDNLADAA"
     MSVTESKAKT ERKSSRKPAK TQETVLSALL AQTEEVSVPL ASLIKSPLNV RTVPYSAESV        60
     SELADSIKGV GLLQNLVVHA LPGDRYGVAA GGRRLAALNM LAERDIIPAD WPVRVKVIPQ       120
     ELATAASMTE NGHRRDMHPA EQIAGFRAMA QEGKTPAQIG DLLGYSPRHV QRMLKLADLA       180
     PVILDALAED RITTEHCQAL ALENDTARQV QVFEAACQSG WGGKPEVQTI RRLVTESEVA       240
     VAGNSKFRFV GADTFSPDEL RTDLFSDDEG GYVDCVALDA ALLEKLQAVA EHLREAEGWE       300
     WCAGRMEPVG FCREDAGTYR SLPEPEAVLT EAEEERLNEL MARYDALENQ CEESDLLEAE       360
     MKLMRCMAKV RAWTPEMRAG SGVVVSWRYG NVCVQRGVQL RSEDDVADND YRTEQVQEKA       420
     SVEEISLPLL TKMSSERTLA VQAALMQQSD KSLALLAWTL CLNVFGSGAY SNPARIRLEC       480
     EHYSLTSDAP SGKEGAAFMA MMAEKARLAA LLPDGWARDM TTFLSLSQEV LLSLLSFCTA       540
     CSIHGVQTRE YGHTSRSPLD TLESAIGFHM RDWWQPTKAN FFGHLKKPQI IAALNEAGLS       600
     GAARDAEKMK KGDAAEHAEH HMKDNRWVPG WMCAPRPQTD ATERTDNLAD AA               652
//

If you have problems or comments...

PBIL Back to PBIL home page