(data stored in SCRATCH zone)

EMBL: CP001163.PE47

CP001163.PE47        Location/Qualifiers
FT   CDS             33503..33937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0069"
FT                   /product="plasmid SOS inhibition protein"
FT                   /note="identified by match to protein family HMM PF06290"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34509"
FT                   /protein_id="ACI34509.1"
FT                   /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDARRELTHAVMRELDAPDN
FT                   WTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVVQV
FT                   QRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     MKTELTLNVL HTMNAQEYED IRAAGSDARR ELTHAVMREL DAPDNWTMNG EYGSEFGGFF        60
     PVQVRFTPAH ERFHLALCSP GDVSQVWVLV LVNAGGEPFA VVQVQRRFAP EAVSHSLALA       120
     ASLDTQGYSV NDIIHILMAE GGQV                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page