(data stored in SCRATCH zone)

EMBL: CP001163.PE48

CP001163.PE48        Location/Qualifiers
FT   CDS             33934..34695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0070"
FT                   /product="putative PsiA protein"
FT                   /note="identified by match to protein family HMM PF06952"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34438"
FT                   /protein_id="ACI34438.1"
FT                   /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRNQGNTLAEYPYAGAFF
FT                   RCLNGSRRISLSDLRFFMPSLTAEELHGNRLQWLYAIDVLIETQGEVCLLPLPGDAAER
FT                   LFPSVRFCVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPETVG
FT                   SWYARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKEAGHA
FT                   VREMERWMVPNKLREVRDAATITRIARKQPE"
     MSARSQALVP LSTEQQAAWR AVAETEKRRN QGNTLAEYPY AGAFFRCLNG SRRISLSDLR        60
     FFMPSLTAEE LHGNRLQWLY AIDVLIETQG EVCLLPLPGD AAERLFPSVR FCVRERSRHK       120
     SALVMQKYSR QQAREAEQKA RAYQALVAQA EIELAFHSPE TVGSWYARWS DRVAEHDLET       180
     LFWQWGERFP SLAGMERWQW QDMPFWQVIA EASLAAKEAG HAVREMERWM VPNKLREVRD       240
     AATITRIARK QPE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page