(data stored in SCRATCH zone)

EMBL: CP001163.PE50

CP001163.PE50        Location/Qualifiers
FT   CDS             35267..37240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34437"
FT                   /protein_id="ACI34437.1"
FT                   /translation="MSIAGLREEPAQDWLSLHKRLASDGLYITMQEGELVVKDGWDRAR
FT                   EGVALSSFGPLWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
FT                   SLKQYACRHFAERLPEMARNGELESCLDVHRTLATAGLWMGIQHGHLVLHDGFDKQQTP
FT                   VRADSVWPLMTLDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRMRM
FT                   GTGPQGAIKRELFSDKESLWGYTTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQ
FT                   HHGLVIVDAFNHELTPVKASSIHPDLTLSRAEPQAGPFEIAGADIFERVKPECRYNPEL
FT                   AASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRKPDLRYGERLREIHAA
FT                   CRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIEEGKWYPLSYR
FT                   QWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEA
FT                   RLQKDGSVRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPGMGFE
FT                   PEGSYQQFNDVFAEMVAWHNAAGITGNGHFVISRPDVDLHRQRSEQYYHEYIRQQKSIS
FT                   GGHGASYAPVQDNEWTPPSPGM"
     MSIAGLREEP AQDWLSLHKR LASDGLYITM QEGELVVKDG WDRAREGVAL SSFGPLWTAE        60
     KLGRKLGEYQ PVPTDIFSQV GTPGRYDPEA INVDIRPEKV AETESLKQYA CRHFAERLPE       120
     MARNGELESC LDVHRTLATA GLWMGIQHGH LVLHDGFDKQ QTPVRADSVW PLMTLDYMQD       180
     LDGGWQPVPK DIFTQVIPGE RFRGRNLGTQ AVSDYEWYRM RMGTGPQGAI KRELFSDKES       240
     LWGYTTVQCE SLIEDMIAGG NFSWQACHEM FARKGLMLQK QHHGLVIVDA FNHELTPVKA       300
     SSIHPDLTLS RAEPQAGPFE IAGADIFERV KPECRYNPEL AASDEVEPGF RRDPVLRRER       360
     REARAAARED LRARYLAWKE HWRKPDLRYG ERLREIHAAC RRRKAYIRVQ FRDPQLRKLH       420
     YHIAEVQRMQ ALIRLKESVK EERLSLIEEG KWYPLSYRQW VEQQAVQGDR AALSQLRGWD       480
     YRDRRKDKRR TTNADRCVIL CEPGGTPLYE DTGVLEARLQ KDGSVRFRDR RNGELVCVDY       540
     GDRVVFYHHQ DRNELVDKLN LIAPVLFDRE PGMGFEPEGS YQQFNDVFAE MVAWHNAAGI       600
     TGNGHFVISR PDVDLHRQRS EQYYHEYIRQ QKSISGGHGA SYAPVQDNEW TPPSPGM          657
//

If you have problems or comments...

PBIL Back to PBIL home page