(data stored in SCRATCH zone)

EMBL: CP001163.PE52

CP001163.PE52        Location/Qualifiers
FT   CDS             39533..49042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0076"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif family protein"
FT                   /note="identified by match to protein family HMM PF04488;
FT                   match to protein family HMM TIGR01586"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34469"
FT                   /protein_id="ACI34469.1"
FT                   /translation="MIHPGSSLDKAINNTRVKNVSTDVKHGQIQERKRNFIYKKNDDIS
FT                   SRFKLYSSLVKQKNATEDVVLIGKMILDEVRSYRTIHNDRNIVSNSGNWKTSFLCNLAR
FT                   LLYSIFNGSNYFCSREGENNSSPSSTLLTIHQPEKQELLQQKSIKHLPTSNNIDGYIKI
FT                   RKTRGAEDQTTTITQSLIINELLNGVDRNTIPFQKISELNDIIHSYENMQIKNSRKGIE
FT                   ILVKQGELLSSLINDNKGNKQLSDNASKIINLLGIEYQSHKVDIEPFIHAVWVAGAPPD
FT                   NTFSYITAFLNTYKDYTYLLWIDPNAFGAAKFSGILKNIAMNYAIMRLRRTNPHLAEEM
FT                   NEVILKIQNIQNETIEFKETRERLKELENRYKSLTSETKEKFNVFFLESMIGMQDNYFT
FT                   YCISNGISNTDDISRLDFLTNVLKLSPEVQNDFKSTVEKNKRDIDLLKNTISQKFGDRF
FT                   QLRDINTLESFKKPQDYFFYQQEMLLRWNYAAASDQVRINILKEYGGIYTDTDILPAYS
FT                   DKVSQIINEKSDDKRFFEDLKLRRIISESILSLIKGEKYSIKHDGLDETTLNQLNNILS
FT                   EIEKLTIDDYFKPVETKVVRDTFKIFKRYQKWTENTWNIRGNNNFMLTHKGSKCIDFIL
FT                   SGQKKQYLELQRIRDNISYNNLFYTTEDLKSLNNVAIGGIPAKKYLEHGLFSEYRQDGT
FT                   IPYVVSTLNISGPDMIMRQMKKYYKSLGRIGEVHIKDNKLSDVNFLGVYASSNKDNKSF
FT                   NWLNPVSVGINDITPDDESSWAVRNNDINKILFEKINCHVPEKLPTSLYYEIDSRSFFQ
FT                   GWDNKSIKHVTEINKDLIKDINLLLTSSNIDVKLLIKLDRELYAISSKIDNPLALRSIR
FT                   TLQLQLANYVTSNTFEPENTINFIYDFYRKKQDDLLSAIKLFSRNDADTKIIVWYNSVM
FT                   EKNVFLREVISCVLRSKKVDSYINENKKNLSKEDAGALRDYAKLKMKELFSMLDDDGYK
FT                   KIITTNAYIKERDKLSGIIYNIENSIISGHESFDIIRSNQHEWGDLSTVEQFKKFEFYV
FT                   KSELSSAKSIFDDIKNKYITDPETKRNVLYHQLDSDIKERIAFLDISHYAYPGSLLEKL
FT                   QLSGYVFSDINIIAEYLLASYGVSGHYSHGVVYPAPSDKLLELLRRHTKSNSEWIEKIT
FT                   PYVYDILSDNVSNVLRPPLSEEQKKILNDIKLEISKSVSEQYFMKLTEQKSSVIGIKYS
FT                   VDFDRYNENLFLSLPINQNLTLPFMYRYFEMLYDIHIGIIENKANREFIYSKFSSLNLD
FT                   FLINDERVLNLEGLIKKYKYLSLSEIHRTLTNSTSFADISIPLLQTICPSITTIIKKTE
FT                   YYGHQLTNAMTVASVVKPYDFSNLGAINSIDKSVSDVPALHTIVEQAKYNLLSWNDFYN
FT                   THASIWDTIARQHKSTNIEFHPQSLLFDRDSKGKCLGLSLLYLDTGGYGGGYQKLRHNI
FT                   DTASTLYQTKYNDNLKLSNRDDFFLRKTQRIITMSNELGNNRLKNAQLEVLELKDPILT
FT                   EGILYQRRISSLLITTEYHSLALQQISSFWRVTDPNFGHCDFHSLAQALTFIKNITSNR
FT                   NFSSLYGSGIVKIYFSESLNNWKYIKLPLVQTGSLLRDIYLTTPEKLSTSGGSLNIMGH
FT                   LVPVSFIYDIGGVINGNRISESTDVKNKIRSLKINGDILQHYINTHYLSEEQTQKIKDI
FT                   VDFLGIQDNTIKVKLESDIKPISEIQQPLHSILSRQKEHVKNLLSGLLDEFSNKLRKQG
FT                   LSLKTNVLSVNNFKESKINSDTVEVTVTDLQGRLYRVDIDTRVIGLTFKEGINSLSEAL
FT                   EHMNIDAIMSVIGLVQYARMIKMNDNISAIDHAGAVSDIKNIVDKFLGGILTLTNNRVY
FT                   NPGGVSGASLEGFISSGLEVCASRMGGTAGRYLSNVAKVIKLPLLDIGINIWSLYDSSL
FT                   NHAKATTQIEYISTAIDVSFSSINTALSIGAIAYPPLAIAIVPITIFSHEVKNYAVYVN
FT                   QINERHKLWLEAEKYLDNGSAKVLSINKATGIIDLSNNQVLGNIYLDMRENPPILHGEK
FT                   SYNSGKNIGSHPDMTDREIMESRAYNFACTKLSDAGEPDIFGWGDKEICNSMELSESQL
FT                   ANGYSNRQWPSQIPVIPEGIYNTVYLGYGETLRANTEVTLSSTGYFYEIARAYTDDELS
FT                   EPLLTVCNQHSHVIGGKEPLTIIIPAIEHGMLGSNLHMIERFKNYNFSISGGKGGIKLM
FT                   VGGIGDYNIECTPGVRNIISFEQLSRDFNLDLDLSDGRKQNFNFHHPSGFYSGKVMSIT
FT                   QKGINAVVGTKLGYDKIRGNNLDNTFSLGSGGGVIYSGGGSNTYFVPATLQDNLHIYIS
FT                   EKSNGNHIILGDMHSRLSIECHFSNNEREFIKMGYYNGCDVILESDTIQKIKSFAKNIT
FT                   IQTADGVMANWDDKLNTLSVYSIDMIAWRDKNKTAKEPLPVDVIQLTNWRMHNTCSLFY
FT                   DKYQVDIEANKLTYTVLFPDTELPVQLNYTSIIYGNHGAKYTFLNSGSKTIDIHILDKN
FT                   SDYDTFDFRNIIFEHYTNEIFISFDNQGGFVISILNNATSEAANINVFRKNMTSLDSSG
FT                   SLIYLPSGDIYHISDIYKMSRGRKSFKLNVEKKPDIDDIINVAILETSYLQIKKIPNND
FT                   DSDYILCLDNPNLSSYTLNFNDLSGYISSLWDNIRGSFTPFHKNTVNIAPNEKKYISLI
FT                   GLDKLSFNIDVFRQALEVKNKNSYKISKFTWETYGDIVVSPEDRISHLELDGFNYFSQP
FT                   ELDTPISDSFSYLYDNFQIVDSDVHIKLLHLNRETKQITPHRIILKRYFIDSFAKTSIT
FT                   DREKNIYPVICDSPDHFTSDIYRHPFRIVLGNKTLYPSEELVKFISTSKEYLSNMDVIN
FT                   NVIVPQKTTKKNKLSIVSLNSNIKNDIVLSGVMTGTSKIFHLNNSGDLLLTTSKTHGGG
FT                   VVVIFKDFINNWWKYNLTLITVPIDNKLSDNRINITPMGIKIQETVSGNDRLFFYPTPL
FT                   KNGCFILHNPLYSNSFPSLYSHELFDLIEAYRNPTYSYLQNNIINRYIHTVSEYAGKDG
FT                   IANMSLSIYAYSTCRFWSKESVAVGDTIKLSNYEHIEFSFNSFSKDYFREQNSDIYKIF
FT                   FKIASSSNSVVVDKNTLTQKNFLENNTFFSITGIDESLYEKHIIFITLKVIVPSKK"
     MIHPGSSLDK AINNTRVKNV STDVKHGQIQ ERKRNFIYKK NDDISSRFKL YSSLVKQKNA        60
     TEDVVLIGKM ILDEVRSYRT IHNDRNIVSN SGNWKTSFLC NLARLLYSIF NGSNYFCSRE       120
     GENNSSPSST LLTIHQPEKQ ELLQQKSIKH LPTSNNIDGY IKIRKTRGAE DQTTTITQSL       180
     IINELLNGVD RNTIPFQKIS ELNDIIHSYE NMQIKNSRKG IEILVKQGEL LSSLINDNKG       240
     NKQLSDNASK IINLLGIEYQ SHKVDIEPFI HAVWVAGAPP DNTFSYITAF LNTYKDYTYL       300
     LWIDPNAFGA AKFSGILKNI AMNYAIMRLR RTNPHLAEEM NEVILKIQNI QNETIEFKET       360
     RERLKELENR YKSLTSETKE KFNVFFLESM IGMQDNYFTY CISNGISNTD DISRLDFLTN       420
     VLKLSPEVQN DFKSTVEKNK RDIDLLKNTI SQKFGDRFQL RDINTLESFK KPQDYFFYQQ       480
     EMLLRWNYAA ASDQVRINIL KEYGGIYTDT DILPAYSDKV SQIINEKSDD KRFFEDLKLR       540
     RIISESILSL IKGEKYSIKH DGLDETTLNQ LNNILSEIEK LTIDDYFKPV ETKVVRDTFK       600
     IFKRYQKWTE NTWNIRGNNN FMLTHKGSKC IDFILSGQKK QYLELQRIRD NISYNNLFYT       660
     TEDLKSLNNV AIGGIPAKKY LEHGLFSEYR QDGTIPYVVS TLNISGPDMI MRQMKKYYKS       720
     LGRIGEVHIK DNKLSDVNFL GVYASSNKDN KSFNWLNPVS VGINDITPDD ESSWAVRNND       780
     INKILFEKIN CHVPEKLPTS LYYEIDSRSF FQGWDNKSIK HVTEINKDLI KDINLLLTSS       840
     NIDVKLLIKL DRELYAISSK IDNPLALRSI RTLQLQLANY VTSNTFEPEN TINFIYDFYR       900
     KKQDDLLSAI KLFSRNDADT KIIVWYNSVM EKNVFLREVI SCVLRSKKVD SYINENKKNL       960
     SKEDAGALRD YAKLKMKELF SMLDDDGYKK IITTNAYIKE RDKLSGIIYN IENSIISGHE      1020
     SFDIIRSNQH EWGDLSTVEQ FKKFEFYVKS ELSSAKSIFD DIKNKYITDP ETKRNVLYHQ      1080
     LDSDIKERIA FLDISHYAYP GSLLEKLQLS GYVFSDINII AEYLLASYGV SGHYSHGVVY      1140
     PAPSDKLLEL LRRHTKSNSE WIEKITPYVY DILSDNVSNV LRPPLSEEQK KILNDIKLEI      1200
     SKSVSEQYFM KLTEQKSSVI GIKYSVDFDR YNENLFLSLP INQNLTLPFM YRYFEMLYDI      1260
     HIGIIENKAN REFIYSKFSS LNLDFLINDE RVLNLEGLIK KYKYLSLSEI HRTLTNSTSF      1320
     ADISIPLLQT ICPSITTIIK KTEYYGHQLT NAMTVASVVK PYDFSNLGAI NSIDKSVSDV      1380
     PALHTIVEQA KYNLLSWNDF YNTHASIWDT IARQHKSTNI EFHPQSLLFD RDSKGKCLGL      1440
     SLLYLDTGGY GGGYQKLRHN IDTASTLYQT KYNDNLKLSN RDDFFLRKTQ RIITMSNELG      1500
     NNRLKNAQLE VLELKDPILT EGILYQRRIS SLLITTEYHS LALQQISSFW RVTDPNFGHC      1560
     DFHSLAQALT FIKNITSNRN FSSLYGSGIV KIYFSESLNN WKYIKLPLVQ TGSLLRDIYL      1620
     TTPEKLSTSG GSLNIMGHLV PVSFIYDIGG VINGNRISES TDVKNKIRSL KINGDILQHY      1680
     INTHYLSEEQ TQKIKDIVDF LGIQDNTIKV KLESDIKPIS EIQQPLHSIL SRQKEHVKNL      1740
     LSGLLDEFSN KLRKQGLSLK TNVLSVNNFK ESKINSDTVE VTVTDLQGRL YRVDIDTRVI      1800
     GLTFKEGINS LSEALEHMNI DAIMSVIGLV QYARMIKMND NISAIDHAGA VSDIKNIVDK      1860
     FLGGILTLTN NRVYNPGGVS GASLEGFISS GLEVCASRMG GTAGRYLSNV AKVIKLPLLD      1920
     IGINIWSLYD SSLNHAKATT QIEYISTAID VSFSSINTAL SIGAIAYPPL AIAIVPITIF      1980
     SHEVKNYAVY VNQINERHKL WLEAEKYLDN GSAKVLSINK ATGIIDLSNN QVLGNIYLDM      2040
     RENPPILHGE KSYNSGKNIG SHPDMTDREI MESRAYNFAC TKLSDAGEPD IFGWGDKEIC      2100
     NSMELSESQL ANGYSNRQWP SQIPVIPEGI YNTVYLGYGE TLRANTEVTL SSTGYFYEIA      2160
     RAYTDDELSE PLLTVCNQHS HVIGGKEPLT IIIPAIEHGM LGSNLHMIER FKNYNFSISG      2220
     GKGGIKLMVG GIGDYNIECT PGVRNIISFE QLSRDFNLDL DLSDGRKQNF NFHHPSGFYS      2280
     GKVMSITQKG INAVVGTKLG YDKIRGNNLD NTFSLGSGGG VIYSGGGSNT YFVPATLQDN      2340
     LHIYISEKSN GNHIILGDMH SRLSIECHFS NNEREFIKMG YYNGCDVILE SDTIQKIKSF      2400
     AKNITIQTAD GVMANWDDKL NTLSVYSIDM IAWRDKNKTA KEPLPVDVIQ LTNWRMHNTC      2460
     SLFYDKYQVD IEANKLTYTV LFPDTELPVQ LNYTSIIYGN HGAKYTFLNS GSKTIDIHIL      2520
     DKNSDYDTFD FRNIIFEHYT NEIFISFDNQ GGFVISILNN ATSEAANINV FRKNMTSLDS      2580
     SGSLIYLPSG DIYHISDIYK MSRGRKSFKL NVEKKPDIDD IINVAILETS YLQIKKIPNN      2640
     DDSDYILCLD NPNLSSYTLN FNDLSGYISS LWDNIRGSFT PFHKNTVNIA PNEKKYISLI      2700
     GLDKLSFNID VFRQALEVKN KNSYKISKFT WETYGDIVVS PEDRISHLEL DGFNYFSQPE      2760
     LDTPISDSFS YLYDNFQIVD SDVHIKLLHL NRETKQITPH RIILKRYFID SFAKTSITDR      2820
     EKNIYPVICD SPDHFTSDIY RHPFRIVLGN KTLYPSEELV KFISTSKEYL SNMDVINNVI      2880
     VPQKTTKKNK LSIVSLNSNI KNDIVLSGVM TGTSKIFHLN NSGDLLLTTS KTHGGGVVVI      2940
     FKDFINNWWK YNLTLITVPI DNKLSDNRIN ITPMGIKIQE TVSGNDRLFF YPTPLKNGCF      3000
     ILHNPLYSNS FPSLYSHELF DLIEAYRNPT YSYLQNNIIN RYIHTVSEYA GKDGIANMSL      3060
     SIYAYSTCRF WSKESVAVGD TIKLSNYEHI EFSFNSFSKD YFREQNSDIY KIFFKIASSS      3120
     NSVVVDKNTL TQKNFLENNT FFSITGIDES LYEKHIIFIT LKVIVPSKK                  3169
//

If you have problems or comments...

PBIL Back to PBIL home page