(data stored in SCRATCH zone)

EMBL: CP001163.PE53

CP001163.PE53        Location/Qualifiers
FT   CDS             complement(49333..49836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0077"
FT                   /product="putative transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527;
FT                   match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34526"
FT                   /protein_id="ACI34526.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGSGDGGLTTAERQRLKELERENRELRVQFFRLLNRRYEKASIILTS
FT                   NKGFADWGEMFGEHVLATAILDRLLHHSTTLNIKGESYRFNIPDRLVVHLSLHARPELR
FT                   AHNT"
     MTKNTRFSPE VRQRAVRMVL ESQGEYDSQW AAICSIAPKI GCTPETLRVW VRQHERDTGS        60
     GDGGLTTAER QRLKELEREN RELRVQFFRL LNRRYEKASI ILTSNKGFAD WGEMFGEHVL       120
     ATAILDRLLH HSTTLNIKGE SYRFNIPDRL VVHLSLHARP ELRAHNT                     167
//

If you have problems or comments...

PBIL Back to PBIL home page