(data stored in SCRATCH zone)

EMBL: CP001163.PE54

CP001163.PE54        Location/Qualifiers
FT   CDS             49983..51281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0079"
FT                   /product="protein TraI"
FT                   /note="identified by match to protein family HMM PF07057"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34506"
FT                   /protein_id="ACI34506.1"
FT                   /translation="MAEGVTLYPPDTIRVGTGDRMRFTKSDRGRGYVANSVWTVTAVSG
FT                   DSVTLSGGQQTRVIRPAQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGSRKLMAG
FT                   FESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVFEPKPDREVMNAERLFST
FT                   ARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPL
FT                   TTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVV
FT                   RIAGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERR
FT                   ADEIVRKMAENKPDLPDGRTEQAVREIAGQERERAVTSEREAALPESVLREPQREREAV
FT                   REVVRENLLQERLQQMERDMVRDLQKEKTLGGD"
     MAEGVTLYPP DTIRVGTGDR MRFTKSDRGR GYVANSVWTV TAVSGDSVTL SGGQQTRVIR        60
     PAQERAEQHI DLAYAITAHG AQGASETFAI ALEGTEGSRK LMAGFESAYV ALSRMKQHVQ       120
     VYTDNRQGWT DAINNAVQKG TAHDVFEPKP DREVMNAERL FSTARELRDV AAGRAVLRQA       180
     GLAGGDSPAR FIAPGRKYPQ PYVALPAFDR NGKSAGIWLN PLTTDDGNGL RGFSGEGRVK       240
     GSGDAQFVAL QGSRNGESLL ADNMQDGVRI ARDNPDSGVV VRIAGEGRPW NPGAITGGRV       300
     WGDIPDNSVQ PGAGNGEPVT AEVLAQRQAE EAIRRETERR ADEIVRKMAE NKPDLPDGRT       360
     EQAVREIAGQ ERERAVTSER EAALPESVLR EPQREREAVR EVVRENLLQE RLQQMERDMV       420
     RDLQKEKTLG GD                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page