(data stored in SCRATCH zone)

EMBL: CP001163.PE56

CP001163.PE56        Location/Qualifiers
FT   CDS             52106..52966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0081"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34467"
FT                   /protein_id="ACI34467.1"
FT                   /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPCF
FT                   ANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIGLW
FT                   GTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAEKKK
FT                   NTGKEMFVGVTRVLSDDESKVFFEKIKARHPEMDIKIPFLTVMETLQYKPAESAASVQC
FT                   PVLVVIAGQDSVNPPEQGRALYDAVASGTKELYEEADACHYDIYEGAFFERVVAVQTQW
FT                   FKQYL"
     MKITDHKLSE GIALTFRVPE GNIKHPLIIL CHGFCGIRNV LLPCFANAFT EAGFATITFD        60
     YRGFGESDGE RGRLVPAMQT EDIISVINWA EKQECIDNQR IGLWGTSLGG GHVFSAAAQD       120
     QRVKCIVSQL AFADGDVLVT GEMNESERAS FLSTLNKMAE KKKNTGKEMF VGVTRVLSDD       180
     ESKVFFEKIK ARHPEMDIKI PFLTVMETLQ YKPAESAASV QCPVLVVIAG QDSVNPPEQG       240
     RALYDAVASG TKELYEEADA CHYDIYEGAF FERVVAVQTQ WFKQYL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page