(data stored in SCRATCH zone)

EMBL: CP001163.PE58

CP001163.PE58        Location/Qualifiers
FT   CDS             53762..53974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34447"
FT                   /protein_id="ACI34447.1"
FT                   /translation="MNGFRNSSRNGQVWRYQRAGSRAVILEVSGRWMEAAEAWRRAAGV
FT                   APRTDWQQFARKRAEHCHRRCRGRG"
     MNGFRNSSRN GQVWRYQRAG SRAVILEVSG RWMEAAEAWR RAAGVAPRTD WQQFARKRAE        60
     HCHRRCRGRG                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page