(data stored in SCRATCH zone)

EMBL: CP001163.PE59

CP001163.PE59        Location/Qualifiers
FT   CDS             54219..54680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0084"
FT                   /product="nuclease homolog"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34505"
FT                   /protein_id="ACI34505.1"
FT                   /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKVVRI
FT                   RLVNIDAPEKKQDYGRWSTDMMKSLVAGKTVTVTYFQRDRYGRMLGQVYAPDGMNVNQF
FT                   MVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
     MRKYIPLVLF IFSWPVLCAD IHGRVVRVLD GDTIEVMDSR KVVRIRLVNI DAPEKKQDYG        60
     RWSTDMMKSL VAGKTVTVTY FQRDRYGRML GQVYAPDGMN VNQFMVRAGA AWVYEQYNTD       120
     PVLPVLQNEA RQQKRGLWSD ADPVPPWIWR HRK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page