(data stored in SCRATCH zone)

EMBL: CP001163.PE6

CP001163.PE6         Location/Qualifiers
FT   CDS             8417..9157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0024"
FT                   /product="site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34436"
FT                   /protein_id="ACI34436.1"
FT                   /translation="MNNVIPLQNSPERVFLLPIAPGVDFATALSLRRMATSTGATPAYL
FT                   LAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGARPFVRILSEKVR
FT                   ARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWAVTDETMRNWLKQAVRRA
FT                   EADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFALDMAA
FT                   TLAVPFTGDGRDAAEILRTLPPLR"
     MNNVIPLQNS PERVFLLPIA PGVDFATALS LRRMATSTGA TPAYLLAPEV SALLFYMPDQ        60
     RHHMLFATLW NTGMRIGEAR MLTPESFDLD GARPFVRILS EKVRARRGRP PKDEVRLVPL       120
     TDISYVRQME SWMITTRPRR REPLWAVTDE TMRNWLKQAV RRAEADGVHF SIPVTPHTFR       180
     HSYIMHMLYH RQPRKVIQAL AGHRDPRSME VYTRVFALDM AATLAVPFTG DGRDAAEILR       240
     TLPPLR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page