(data stored in SCRATCH zone)

EMBL: CP001163.PE62

CP001163.PE62        Location/Qualifiers
FT   CDS             55551..55805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0087"
FT                   /product="replication regulatory protein repA2"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34463"
FT                   /protein_id="ACI34463.1"
FT                   /translation="MSQTENAVTSSSGAKRAYRKGNPLSDAEKQRLSVARKRASFKEVK
FT                   VFLEPKYKAMLMQMCHEDGLTQAEVLTALIKSEAQKRCV"
     MSQTENAVTS SSGAKRAYRK GNPLSDAEKQ RLSVARKRAS FKEVKVFLEP KYKAMLMQMC        60
     HEDGLTQAEV LTALIKSEAQ KRCV                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page