(data stored in SCRATCH zone)

EMBL: CP001163.PE64

CP001163.PE64        Location/Qualifiers
FT   CDS             complement(57040..57159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34485"
FT                   /protein_id="ACI34485.1"
FT                   /translation="MQFNVDKQNCPSVRRVLYQNRGDRMHQKVDDEVVFGMWC"
     MQFNVDKQNC PSVRRVLYQN RGDRMHQKVD DEVVFGMWC                               39
//

If you have problems or comments...

PBIL Back to PBIL home page