(data stored in SCRATCH zone)

EMBL: CP001163.PE66

CP001163.PE66        Location/Qualifiers
FT   CDS             57878..58162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0092"
FT                   /product="CopG family protein"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34433"
FT                   /protein_id="ACI34433.1"
FT                   /translation="MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQAL
FT                   SAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAWADSLSTDNPLPVPR"
     MQMKNNTAQA TKVITAHVPL PMADKVDQMA ARLERSRGWV IKQALSAWLA QEEERNRLTL        60
     EALDDVTSGQ VIDHQAVQAW ADSLSTDNPL PVPR                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page