(data stored in SCRATCH zone)

EMBL: CP001163.PE67

CP001163.PE67        Location/Qualifiers
FT   CDS             58162..58437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0093"
FT                   /product="plasmid stabilization system protein, RelE/ParE
FT                   family"
FT                   /note="identified by match to protein family HMM PF05016"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34508"
FT                   /protein_id="ACI34508.1"
FT                   /translation="MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTH
FT                   PRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIYVLRLWHTRENR"
     MELKWSSKAL SDLARLYDFL VLASKPAAAR TVQSLTQAPV ILLTHPRMGE QLFQFEPREV        60
     RRIFAGEYEI RYELNGQTIY VLRLWHTREN R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page