(data stored in SCRATCH zone)

EMBL: CP001163.PE68

CP001163.PE68        Location/Qualifiers
FT   CDS             58532..58738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34520"
FT                   /protein_id="ACI34520.1"
FT                   /translation="MNYDEITKITAERISDYMTEAVNTDSIAVAEMFHNAAWGVRTLWF
FT                   ELVTKIDIDIHKKNRYASYDLDR"
     MNYDEITKIT AERISDYMTE AVNTDSIAVA EMFHNAAWGV RTLWFELVTK IDIDIHKKNR        60
     YASYDLDR                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page