(data stored in SCRATCH zone)

EMBL: CP001163.PE69

CP001163.PE69        Location/Qualifiers
FT   CDS             complement(58823..59044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0095"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34449"
FT                   /protein_id="ACI34449.1"
FT                   /translation="MIPDALAAEGSSKRDWNRFLDSHYRRGWNVNVSRVMDNATHVAVY
FT                   FGSYLKKPPVPMSRLEHYAGQDEIDPFN"
     MIPDALAAEG SSKRDWNRFL DSHYRRGWNV NVSRVMDNAT HVAVYFGSYL KKPPVPMSRL        60
     EHYAGQDEID PFN                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page