(data stored in SCRATCH zone)

EMBL: CP001163.PE7

CP001163.PE7         Location/Qualifiers
FT   CDS             9247..9366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34456"
FT                   /protein_id="ACI34456.1"
FT                   /translation="MFYEGSNASASGYGVTHVRDRQMTAQLQAALQETEYKLQ"
     MFYEGSNASA SGYGVTHVRD RQMTAQLQAA LQETEYKLQ                               39
//

If you have problems or comments...

PBIL Back to PBIL home page