(data stored in SCRATCH zone)

EMBL: CP001163.PE70

CP001163.PE70        Location/Qualifiers
FT   CDS             complement(59097..59831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0096"
FT                   /product="ISSd1, transposase OrfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34451"
FT                   /protein_id="ACI34451.1"
FT                   /translation="MDTVSAESGSRLSVAAYCVHTSLPVLVPGVPQPVVTGRDEPHCCG
FT                   CDTGNLPPGRCATTNSNHNLPVAPNLLNQTFAPAAPNQVWVADLTYVATQEGWLYLAGI
FT                   KDVYTCEIVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQE
FT                   QFGLKTSMSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQR
FT                   RHSRLGNISPAAFREKYHQMAA"
     MDTVSAESGS RLSVAAYCVH TSLPVLVPGV PQPVVTGRDE PHCCGCDTGN LPPGRCATTN        60
     SNHNLPVAPN LLNQTFAPAA PNQVWVADLT YVATQEGWLY LAGIKDVYTC EIVGYAMGER       120
     MTKELTGKAL FMALRSQRPP AGLIHHSDRG SQYCAYDYRV IQEQFGLKTS MSRKGNCYDN       180
     APMESFWGTL KNESLSHYRF NNRDEAISVI REYIEIFYNR QRRHSRLGNI SPAAFREKYH       240
     QMAA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page