(data stored in SCRATCH zone)

EMBL: CP001163.PE74

CP001163.PE74        Location/Qualifiers
FT   CDS             62695..63084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0100"
FT                   /product="cytochrome b562 family protein"
FT                   /note="identified by match to protein family HMM PF07361"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34493"
FT                   /protein_id="ACI34493.1"
FT                   /translation="MQKSNKVIISCGMALYFLCGGITVAEELDESMQVLARNMSVLQSS
FT                   MDKKELLEALDRMDDAVDESMKRLPESISPADEEGKNDYIKELQKLEKEIMLAKQKVLS
FT                   GQLSDIPDSVNKMNKIRVEGHDKFR"
     MQKSNKVIIS CGMALYFLCG GITVAEELDE SMQVLARNMS VLQSSMDKKE LLEALDRMDD        60
     AVDESMKRLP ESISPADEEG KNDYIKELQK LEKEIMLAKQ KVLSGQLSDI PDSVNKMNKI       120
     RVEGHDKFR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page