(data stored in SCRATCH zone)

EMBL: CP001163.PE8

CP001163.PE8         Location/Qualifiers
FT   CDS             complement(9442..10419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0026"
FT                   /product="initiator RepB protein"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34471"
FT                   /protein_id="ACI34471.1"
FT                   /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNTL
FT                   SRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVELP
FT                   FVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSAYYD
FT                   TERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPAPVSL
FT                   ARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPRLKAPN
FT                   DESKENPLPPSPAEKVSPEMAEKLALLEKLGITLDDLEKLFKSR"
     MDKSSGELVT LTPNNNNTVQ PVALMRLGVF VPTLKSLKNS KKNTLSRTDA TEELTRLSLA        60
     RAEGFDKVEI TGPRLDMDND FKTWVGIIHS FARHNVIGDK VELPFVEFAK LCGIPSSQSS       120
     RRLRERISPS LKRIAGTVIS FSRTDEKHTR EYITHLVQSA YYDTERDIVQ LQADPRLFEL       180
     YQFDRKVLLQ LKAINALKRR ESAQALYTFI ESLPRDPAPV SLARLRARLN LKSPVFSQNQ       240
     TVRRAMEQLR EIGYLDYTEI QRGRTKLFCI HYRRPRLKAP NDESKENPLP PSPAEKVSPE       300
     MAEKLALLEK LGITLDDLEK LFKSR                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page