(data stored in SCRATCH zone)

EMBL: CP001163.PE84

CP001163.PE84        Location/Qualifiers
FT   CDS             70391..71212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0111"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34498"
FT                   /protein_id="ACI34498.1"
FT                   /translation="MLNARHLPVLMYHHVSRCPGLVTLSPETFCEQMKWLADNNWRTVT
FT                   SAELEYFYQGGTLPRKSVMLTFDDGYLDNWLRAWPVLKEYNLHAHIFLITGLIGKGNVR
FT                   SRQEQEYSHRDCERLIADNRSDEVMLRWSEVREMRDSGLVEFHVHTHSHKRWDRLSVSR
FT                   AEQCRLMKEDILVGKQCLTEKLGFCSSHLCWPEGYYNRDYINLAGKLGFSYLYTTERRM
FT                   NCPENGSLRIGRISTKEREHSGWLKRRLFYYTTPLFSSVLALHKGPRLPDN"
     MLNARHLPVL MYHHVSRCPG LVTLSPETFC EQMKWLADNN WRTVTSAELE YFYQGGTLPR        60
     KSVMLTFDDG YLDNWLRAWP VLKEYNLHAH IFLITGLIGK GNVRSRQEQE YSHRDCERLI       120
     ADNRSDEVML RWSEVREMRD SGLVEFHVHT HSHKRWDRLS VSRAEQCRLM KEDILVGKQC       180
     LTEKLGFCSS HLCWPEGYYN RDYINLAGKL GFSYLYTTER RMNCPENGSL RIGRISTKER       240
     EHSGWLKRRL FYYTTPLFSS VLALHKGPRL PDN                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page