(data stored in SCRATCH zone)

EMBL: CP001163.PE85

CP001163.PE85        Location/Qualifiers
FT   CDS             71215..72318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0112"
FT                   /product="UDP-sugar hydrolase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34474"
FT                   /protein_id="ACI34474.1"
FT                   /translation="MKILFTESSSDIGGQELQALAQMTALQKQGHSVLLACREKSKIAP
FT                   EARKRGHDVTFIPFRNSLHLPSILRLRRIIGEFKPDLVICHSGHDSNIAGLSRLICCHR
FT                   FSIVRQKTYITRKTRTFSLNYLCDFIVVPSSAMMAHLMAEGVRTPVTVIPPGFDWPALH
FT                   NEAMRPLPLHIHAWAASADNVPLIVQVGMLRPEKGHEFMLRVLYQLKMEGKSFRWLVVG
FT                   AGREEYEARLRQQTEHLGMSGDVLMAGALFPALPVYRIASVVVMPSENEAFGMVLAEAS
FT                   VSGVPVIASETGGIPDVIQKNVTGTLLPVGDVSAWTGALRDFLSRPERFRMMAASARED
FT                   IEYRFDINRTAQIIVSLASQAKGKCNR"
     MKILFTESSS DIGGQELQAL AQMTALQKQG HSVLLACREK SKIAPEARKR GHDVTFIPFR        60
     NSLHLPSILR LRRIIGEFKP DLVICHSGHD SNIAGLSRLI CCHRFSIVRQ KTYITRKTRT       120
     FSLNYLCDFI VVPSSAMMAH LMAEGVRTPV TVIPPGFDWP ALHNEAMRPL PLHIHAWAAS       180
     ADNVPLIVQV GMLRPEKGHE FMLRVLYQLK MEGKSFRWLV VGAGREEYEA RLRQQTEHLG       240
     MSGDVLMAGA LFPALPVYRI ASVVVMPSEN EAFGMVLAEA SVSGVPVIAS ETGGIPDVIQ       300
     KNVTGTLLPV GDVSAWTGAL RDFLSRPERF RMMAASARED IEYRFDINRT AQIIVSLASQ       360
     AKGKCNR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page