(data stored in SCRATCH zone)

EMBL: CP001163.PE86

CP001163.PE86        Location/Qualifiers
FT   CDS             72408..74129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0113"
FT                   /product="sulfatase domain protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34507"
FT                   /protein_id="ACI34507.1"
FT                   /translation="MHLNTGQNRPTFSWSALGWAIFYFGFFSTLLQVIIFSSGYSGTNG
FT                   IRDSLLFSCLWLIPVFLYPDRIKIIAAVVGFILWGTSLAALCYYFLYGHEFSQSVLFVM
FT                   FETNAREAGEYFSQYFSLKLLLISLVYTAVSVFLWTRLRPVYIPLPWRRIVSFLLLYAL
FT                   LLHPVVLKSLIRQEPLNDTLGKLASRMEPAAPWQFVSSYYQYHQQLNALTTFLNENSAL
FT                   PPLGNLRDESGERPRTLVLVIGESTQRERMSLYGYLRETTPELDALRKTDPGLTVFNNV
FT                   VASRPYTIEALQQALTFANEKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTITARNTML
FT                   TVFSRQTDRQYYMNQQRTQSAREYDTNVLKPFREVLNDPAPKKLIIVHLLGTHIKYKYR
FT                   YPEGQGRFDGITGHIPTGLNAKELEVYNDYDNANLFNDHVVASLIKDFRATAPDGFLLY
FT                   FSDHGEEVYDTPPYKTQGRNEDNPTRPMYTVPFLLWTSEKWHAAHPRDFSQYVDRKYSL
FT                   AELIHTWSDLAGLTYDGYDPTRSLVNPQFRETTRWIGNPYKKNGLTDFDTLPYGEP"
     MHLNTGQNRP TFSWSALGWA IFYFGFFSTL LQVIIFSSGY SGTNGIRDSL LFSCLWLIPV        60
     FLYPDRIKII AAVVGFILWG TSLAALCYYF LYGHEFSQSV LFVMFETNAR EAGEYFSQYF       120
     SLKLLLISLV YTAVSVFLWT RLRPVYIPLP WRRIVSFLLL YALLLHPVVL KSLIRQEPLN       180
     DTLGKLASRM EPAAPWQFVS SYYQYHQQLN ALTTFLNENS ALPPLGNLRD ESGERPRTLV       240
     LVIGESTQRE RMSLYGYLRE TTPELDALRK TDPGLTVFNN VVASRPYTIE ALQQALTFAN       300
     EKNPDLYLTQ PSLMNMMKQA GYKTFWITNQ QTITARNTML TVFSRQTDRQ YYMNQQRTQS       360
     AREYDTNVLK PFREVLNDPA PKKLIIVHLL GTHIKYKYRY PEGQGRFDGI TGHIPTGLNA       420
     KELEVYNDYD NANLFNDHVV ASLIKDFRAT APDGFLLYFS DHGEEVYDTP PYKTQGRNED       480
     NPTRPMYTVP FLLWTSEKWH AAHPRDFSQY VDRKYSLAEL IHTWSDLAGL TYDGYDPTRS       540
     LVNPQFRETT RWIGNPYKKN GLTDFDTLPY GEP                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page