(data stored in SCRATCH zone)

EMBL: CP001163.PE89

CP001163.PE89        Location/Qualifiers
FT   CDS             75548..75949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0116"
FT                   /product="IS66 family element, orf1"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34511"
FT                   /protein_id="ACI34511.1"
FT                   /translation="MGTKVSDMQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKL
FT                   ALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPEPLSISC
FT                   EVTFRHGTLRFNGNVSEKLLTLLIQELKR"
     MGTKVSDMQK NVTPGRRKGC PNYPPEFKQQ LVAASCEPGI SISKLALENG INANLLFKWR        60
     QQWREGKLLL PSSESPQLLP VTLDAAAEQP ESLAEDPEPL SISCEVTFRH GTLRFNGNVS       120
     EKLLTLLIQE LKR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page