(data stored in SCRATCH zone)

EMBL: CP001163.PE9

CP001163.PE9         Location/Qualifiers
FT   CDS             complement(10412..10582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34444"
FT                   /protein_id="ACI34444.1"
FT                   /translation="MVSTPDSAVKYRLQVFLQSVSGALTHDLLFILLLSTGRRLSGKRK
FT                   FRHQKTVRRGG"
     MVSTPDSAVK YRLQVFLQSV SGALTHDLLF ILLLSTGRRL SGKRKFRHQK TVRRGG            56
//

If you have problems or comments...

PBIL Back to PBIL home page