(data stored in SCRATCH zone)

EMBL: CP001163.PE90

CP001163.PE90        Location/Qualifiers
FT   CDS             75946..76293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0117"
FT                   /product="IS66 family element, orf2"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34420"
FT                   /protein_id="ACI34420.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
     MIPLPSGTKI WLVAGITDMR NGFNGLAAKV QTALKDDPMS GHVFIFRGRS GSQVKLLWST        60
     GDGLCLLTKR LERGRFAWPS ARDGKVFLTQ AQLAMLLEGI DWRQPKRLLT SLTML            115
//

If you have problems or comments...

PBIL Back to PBIL home page