(data stored in SCRATCH zone)

EMBL: CP001163.PE91

CP001163.PE91        Location/Qualifiers
FT   CDS             76343..77881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0118"
FT                   /product="IS66 family element, transposase"
FT                   /note="identified by match to protein family HMM PF03050"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34460"
FT                   /protein_id="ACI34460.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLLRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGALLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
     MNDISSDDIF LLKQRLAEQE ALIHALQEKL SNREREIDHL QAQLDKLRRM NFGSRSEKVS        60
     RRIAQMEADL NRLQKESDTL TGRVYDPAVQ RPLRQTRTRK PFPESLPRDE KRLLPAAPCC       120
     PNCGGSLSYL GEDTAEQLEL MRSAFRVIRT VREKHACTQC DAIVQAPAPS RPIERGIAGP       180
     GLLARVLTSK YAEHTPLYRQ SEIYGRQGVE LRRSLLSGWV DACCRLLSPL EEALHGYVMT       240
     DGKLHADDTP VQVLLPGNKK TKTGRLWAYV RDDRNAGSAL APAVWFAYSP DRKGIHPQTH       300
     LACFSGVLQA DAYAGFNELY RNGGITEAAC WAHARRKIHD VHVRIPSALT EEALEQIGQL       360
     YAIEADIRGM PAEQRLAERQ RKTKPLLKSL ESWLREKMKT LLRHSELAKA FAYALNQWPA       420
     LTYYANDGWV EIDNNIAENA LRAVSLGRKN FLFFGSDHGG ERGALLYSLI GTCKLNDVDP       480
     ESYLRHVLGV IADWPVNRVS ELLPWRIALP AE                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page