(data stored in SCRATCH zone)

EMBL: CP001163.PE94

CP001163.PE94        Location/Qualifiers
FT   CDS             78551..81247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34517"
FT                   /protein_id="ACI34517.1"
FT                   /translation="MNTKMNERWRTPMKLKYLSCTILAPLAIGVFSATAADNNSAIYFN
FT                   TSQPINDLQGSLAAEVKFAQSQILPAHPKEGDSQPHLTSLRKSLLLVRPVKADDKTPVQ
FT                   VEARDDNNKILGTLTLYPPSSLPDTIYHLDGVPEGGIDFTPHNGTKKIINTVAEVNKLS
FT                   DASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTVFYGD
FT                   RKVTLSVGNTLLFKYVNGQWFRSGELENNRITYAQHIWSAELPAHWIVPGLNLVIKQGN
FT                   LSGRLNDIKIGAPGELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNY
FT                   APLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGE
FT                   NSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYV
FT                   DGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDA
FT                   MAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVFDSRSSTGFSKWNADTQEMEPYEHTI
FT                   DRAEQITASVNELSESKMAELMAEYAVVKVHMWNGNWTRNIYIPTASADNRGSILTINH
FT                   EAGYNSYLFINGDEKVVSQGYKKSFVSDGQFWKERDVVDTREARKPEQFGVPVTTLVGY
FT                   YDPEGTLSSYIYPAMYGAYGFTYSDDSQNLSDNDCQLQVDTKEGQLRFRLANHRANNTV
FT                   MNKFHINVPTESQPTQATLVCNNKILDTKSLTPAPEGLTYTVNGQALPAKENEGCIVSV
FT                   NSGKRYCLPVGQRSGYSLPDWIVGQEVYVDSGAKAKVLLSDWDNLSYNRIGEFVGNVNP
FT                   ADMKKVKAWNGQYLDFSKPRSMRVVYK"
     MNTKMNERWR TPMKLKYLSC TILAPLAIGV FSATAADNNS AIYFNTSQPI NDLQGSLAAE        60
     VKFAQSQILP AHPKEGDSQP HLTSLRKSLL LVRPVKADDK TPVQVEARDD NNKILGTLTL       120
     YPPSSLPDTI YHLDGVPEGG IDFTPHNGTK KIINTVAEVN KLSDASGSSI HSHLTNNALV       180
     EIHTANGRWV RDIYLPQGPD LEGKMVRFVS SAGYSSTVFY GDRKVTLSVG NTLLFKYVNG       240
     QWFRSGELEN NRITYAQHIW SAELPAHWIV PGLNLVIKQG NLSGRLNDIK IGAPGELLLH       300
     TIDIGMLTTP RDRFDFAKDK EAHREYFQTI PVSRMIVNNY APLHLKEVML PTGELLTDMD       360
     PGNGGWHSGT MRQRIGKELV SHGIDNANYG LNSTAGLGEN SHPYVVAQLA AHNSRGNYAN       420
     GIQVHGGSGG GGIVTLDSTL GNEFSHEVGH NYGLGHYVDG FKGSVHRSAE NNNSTWGWDG       480
     DKKRFIPNFY PSQTNEKSCL NNQCQEPFDG HKFGFDAMAG GSPFSAANRF TMYTPNSSAI       540
     IQRFFENKAV FDSRSSTGFS KWNADTQEME PYEHTIDRAE QITASVNELS ESKMAELMAE       600
     YAVVKVHMWN GNWTRNIYIP TASADNRGSI LTINHEAGYN SYLFINGDEK VVSQGYKKSF       660
     VSDGQFWKER DVVDTREARK PEQFGVPVTT LVGYYDPEGT LSSYIYPAMY GAYGFTYSDD       720
     SQNLSDNDCQ LQVDTKEGQL RFRLANHRAN NTVMNKFHIN VPTESQPTQA TLVCNNKILD       780
     TKSLTPAPEG LTYTVNGQAL PAKENEGCIV SVNSGKRYCL PVGQRSGYSL PDWIVGQEVY       840
     VDSGAKAKVL LSDWDNLSYN RIGEFVGNVN PADMKKVKAW NGQYLDFSKP RSMRVVYK         898
//

If you have problems or comments...

PBIL Back to PBIL home page