(data stored in SCRATCH zone)

EMBL: CP001163.REPA

CP001163.REPA        Location/Qualifiers
FT   CDS             56108..56965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="ECH74115_B0089"
FT                   /product="replication initiation protein"
FT                   /note="identified by match to protein family HMM PF02387;
FT                   match to protein family HMM TIGR03474"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34421"
FT                   /protein_id="ACI34421.1"
FT                   /translation="MTDLQQTYYRQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSRF
FT                   DFAIHVAHARSKGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLA
FT                   TESAAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDVSED
FT                   AVAAARRSRVEWENRLRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIKRARA
FT                   RRDAGRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKERMILSRNRNYSRLA
FT                   TASP"
     MTDLQQTYYR QVKNPNPVFT PREGAGTLKF CEKLMEKAVG FTSRFDFAIH VAHARSKGLR        60
     RRMPPVLRRR AIDALLQGLC FHYDPLANRV QCSITTLAIE CGLATESAAG KLSITRATRA       120
     LTFLSELGLI TYQTEYDPLI GCYIPTDITF TPALFAALDV SEDAVAAARR SRVEWENRLR       180
     KKQGLDTLGM DELIAKAWRF VRERFRSYQT ELKSRGIKRA RARRDAGRER QDIVTLVKRQ       240
     LTREISEGRF TANREAVKRE VERRVKERMI LSRNRNYSRL ATASP                       285
//

If you have problems or comments...

PBIL Back to PBIL home page