(data stored in SCRATCH zone)

EMBL: CP001163.SOPA

CP001163.SOPA        Location/Qualifiers
FT   CDS             18792..19949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopA"
FT                   /locus_tag="ECH74115_B0045"
FT                   /product="plasmid partition protein A"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34522"
FT                   /protein_id="ACI34522.1"
FT                   /translation="METLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGEAADL
FT                   VGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAEDVFPP
FT                   VIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAED
FT                   TLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTDPHLMLR
FT                   LAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDL
FT                   LKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQI
FT                   RMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
     METLNQCINA GHEMTKAIAI AQFNDDSPEA RKITRRWRIG EAADLVGVSS QAIRDAEKAG        60
     RLPHPDMEIR GRVEQRVGYT IEQINHMRDV FGTRLRRAED VFPPVIGVAA HKGGVYKTSV       120
     SVHLAQDLAL KGLRVLLVEG NDPQGTASMY HGWVPDLHIH AEDTLLPFYL GEKDDVTYAI       180
     KPTCWPGLDI IPSCLALHRI ETELMGKFDE GKLPTDPHLM LRLAIETVAH DYDVIVIDSA       240
     PNLGIGTINV VCAADVLIVP TPAELFDYTS ALQFFDMLRD LLKNVDLKGF EPDVRILLTK       300
     YSNSNGSQSP WMEEQIRDAW GSMVLKNVVR ETDEVGKGQI RMRTVFEQAI DQRSSTGAWR       360
     NALSIWEPVC NEIFDRLIKP RWEIR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page