(data stored in SCRATCH zone)

EMBL: CP001163.SOPB

CP001163.SOPB        Location/Qualifiers
FT   CDS             19949..20920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopB"
FT                   /locus_tag="ECH74115_B0046"
FT                   /product="plasmid partition protein B"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34524"
FT                   /protein_id="ACI34524.1"
FT                   /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNA
FT                   ITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP
FT                   AFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER
FT                   GQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGD
FT                   ALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQF
FT                   APGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"
     MKRAPVIPKH TLNTQPVEDT SLSTPAAPMV DSLIARVGVM ARGNAITLPV CGRDVKFTLE        60
     VLRGDSVEKT SRVWSGNERD QELLTEDALD DLIPSFLLTG QQTPAFGRRV SGVIEIADGS       120
     RRRKAAALTE SDYRVLVGEL DDEQMAALSR LGNDYRPTSA YERGQRYASR LQNEFAGNIS       180
     ALADAENISR KIITRCINTA KLPKSVVALF SHPGELSARS GDALQKAFTD KEELLKQQAS       240
     NLHEQKKAGV IFEAEEVITL LTSVLKTSSA SRTSLSSRHQ FAPGATVLYK GDKMVLNLDR       300
     SRVPTECIEK IEAILKELEK PAP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page