(data stored in SCRATCH zone)

EMBL: CP001163.TRAX

CP001163.TRAX        Location/Qualifiers
FT   CDS             51301..52047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="ECH74115_B0080"
FT                   /product="type-F conjugative transfer system pilin
FT                   acetylase TraX"
FT                   /note="identified by match to protein family HMM PF05857;
FT                   match to protein family HMM TIGR02755"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34462"
FT                   /protein_id="ACI34462.1"
FT                   /translation="MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMV
FT                   LDHANRILHLDQTWMFLAGRGAFPLFALVWGLNLSRHAHIRQSAINRLWGWGIIAQFAY
FT                   YLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLM
FT                   LAVSHRLYRAEDRTERLVLVACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSCAGKS
FT                   LPRFWPGDFFPTFYGCHLAVLGILAL"
     MTTDNTNTTR NDSLAARTDT WLQSLLVWSP GQRDIIKTVA LVLMVLDHAN RILHLDQTWM        60
     FLAGRGAFPL FALVWGLNLS RHAHIRQSAI NRLWGWGIIA QFAYYLAGFP WYEGNILFAF       120
     AVAAQVLTWC ETRSGWRTAA AILLMALWGP LSGTSYGIAG LLMLAVSHRL YRAEDRTERL       180
     VLVACLLAVI PALNLASSDA AAVAGLVMTV LTVGLVSCAG KSLPRFWPGD FFPTFYGCHL       240
     AVLGILAL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page