(data stored in ACNUC30630 zone)

EMBL: CP001275.AROA

CP001275.AROA        Location/Qualifiers
FT   CDS             complement(245911..247215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="trd_0235"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04612"
FT                   /db_xref="GOA:B9KXP8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP8"
FT                   /protein_id="ACM04612.1"
FT                   /translation="MTLHRTYPPRLPIRPAEQPVDAIVRLPGSKSLTNRALVLAALADG
FT                   VSVLEGALLSEDSWVMVDSLRRLGIPVDVDEPAERMIVQGKGGTLPATRAELFVGNSGT
FT                   TARFLTAMTALGHGEYLIDGVPRMRERPIQPLLDALAQLGVQAESLLGTGCPPVRVRSY
FT                   GLAGGTIRLRGDISSQYLSALLMIGPCTRDGLRIELESPLVSVPYVEMTLAVMADFGAI
FT                   ATHEHAQVFHVPGNQRYRSRTYAIEPDASAASYFFALAAATAGRIRVVNLGTRSRQGDV
FT                   QFVDLLERMGCTVIREPDALTVIGKRPLRGIEADMNAISDTVPTLAALAPLADGPVIIR
FT                   NVQHIRYKETDRIAAVANELRRLGITVEEFPDGLRIEPGPVQPAVIRTYGDHRMAMSFA
FT                   ILGCAVPGLEIDDPGCVAKTFPDFFERLEAALGRR"
     MTLHRTYPPR LPIRPAEQPV DAIVRLPGSK SLTNRALVLA ALADGVSVLE GALLSEDSWV        60
     MVDSLRRLGI PVDVDEPAER MIVQGKGGTL PATRAELFVG NSGTTARFLT AMTALGHGEY       120
     LIDGVPRMRE RPIQPLLDAL AQLGVQAESL LGTGCPPVRV RSYGLAGGTI RLRGDISSQY       180
     LSALLMIGPC TRDGLRIELE SPLVSVPYVE MTLAVMADFG AIATHEHAQV FHVPGNQRYR       240
     SRTYAIEPDA SAASYFFALA AATAGRIRVV NLGTRSRQGD VQFVDLLERM GCTVIREPDA       300
     LTVIGKRPLR GIEADMNAIS DTVPTLAALA PLADGPVIIR NVQHIRYKET DRIAAVANEL       360
     RRLGITVEEF PDGLRIEPGP VQPAVIRTYG DHRMAMSFAI LGCAVPGLEI DDPGCVAKTF       420
     PDFFERLEAA LGRR                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page