(data stored in ACNUC30630 zone)

EMBL: CP001275.AROC

CP001275.AROC        Location/Qualifiers
FT   CDS             244839..245906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="trd_0234"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05856"
FT                   /db_xref="GOA:B9KXP7"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP7"
FT                   /protein_id="ACM05856.1"
FT                   /translation="MGSTFGRLFRVTTWGESHGPALGVVVDGCPAGLELNEEIIQRDLD
FT                   RRRVGQSEVTSPRQERDRVTILSGVFEGKTTGAPISLITYNADADSSKYEPLRDVFRPG
FT                   HADYTYWVKYGHRDHRGGGRSSARETWGRVAAGAIARQLLRTVAGVEVYGFVRELGGIT
FT                   IETFDRDEIDRNPVRCPDPVAAQKMVAAILEAKEQKTSVGGIVEVRARNVPPGLGEPTM
FT                   DKLDALIGYAMLSIPAVKGVEIGDGFAAARLRGHEHNDPFILDNGRVRTLTNHAGGMLG
FT                   GISTGEEIIVRLAVKPTSSIARPQRTVDIHGNERTIVVEGRHDPSICPRVVPVAEAMLL
FT                   LVLADCYLMNRAARV"
     MGSTFGRLFR VTTWGESHGP ALGVVVDGCP AGLELNEEII QRDLDRRRVG QSEVTSPRQE        60
     RDRVTILSGV FEGKTTGAPI SLITYNADAD SSKYEPLRDV FRPGHADYTY WVKYGHRDHR       120
     GGGRSSARET WGRVAAGAIA RQLLRTVAGV EVYGFVRELG GITIETFDRD EIDRNPVRCP       180
     DPVAAQKMVA AILEAKEQKT SVGGIVEVRA RNVPPGLGEP TMDKLDALIG YAMLSIPAVK       240
     GVEIGDGFAA ARLRGHEHND PFILDNGRVR TLTNHAGGML GGISTGEEII VRLAVKPTSS       300
     IARPQRTVDI HGNERTIVVE GRHDPSICPR VVPVAEAMLL LVLADCYLMN RAARV            355
//

If you have problems or comments...

PBIL Back to PBIL home page